PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_014957
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 755aa    MW: 84018.6 Da    PI: 9.5002
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_014957genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.62e-31186242360
                  -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+++ ei+Y+geH+h+k
  DCAR_014957 186 DGYNWRKYGQKHVKGSEYPRSYYKCTHPNCPVKKKVERSL-DGQIAEIVYQGEHHHSK 242
                  9***************************************.***************85 PP

2WRKY1017e-32386443259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   Dg++WrKYGqK vkg+++prsYYrCt  +C+v+k+ver+++dp+++++tYeg+Hnh+
  DCAR_014957 386 GDGFRWRKYGQKIVKGNPNPRSYYRCTGLRCNVRKHVERASDDPTAFITTYEGKHNHH 443
                  59*******************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.3E-28177243IPR003657WRKY domain
SuperFamilySSF1182901.14E-24183243IPR003657WRKY domain
SMARTSM007741.2E-34184242IPR003657WRKY domain
PROSITE profilePS5081123.135186243IPR003657WRKY domain
PfamPF031065.6E-24186240IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-31374445IPR003657WRKY domain
PROSITE profilePS5081133.648380445IPR003657WRKY domain
SuperFamilySSF1182904.45E-27380445IPR003657WRKY domain
SMARTSM007746.0E-36385444IPR003657WRKY domain
PfamPF031063.2E-25387443IPR003657WRKY domain
Gene3DG3DSA:2.60.120.2001.2E-8474512IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF561121.2E-48484729IPR011009Protein kinase-like domain
PROSITE profilePS5001122.478498754IPR000719Protein kinase domain
SMARTSM002202.0E-11498711IPR000719Protein kinase domain
PfamPF077142.1E-26503637IPR001245Serine-threonine/tyrosine-protein kinase catalytic domain
PROSITE patternPS001070504527IPR017441Protein kinase, ATP binding site
Gene3DG3DSA:3.30.200.205.7E-26513561No hitNo description
Gene3DG3DSA:1.10.510.102.6E-17562636No hitNo description
PROSITE patternPS001080621633IPR008271Serine/threonine-protein kinase, active site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006468Biological Processprotein phosphorylation
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 755 aa     Download sequence    Send to blast
MEERTGIVKP VACRPTVRAI SVLLSANINA STSNSTSQPV VLATRPKTVR VKPVVKLISS  60
KDKALGTTVS SSLDRDLKVE NKSTVVYKPL AKLVSKRTIS LLANMENSCF QHHEALPQSD  120
PCSPSPNQVH CHLKSENNLN GSSNKTTTSE SKREIKPLQR MVAEDSSKEY KDKLLPTNTV  180
DRPSYDGYNW RKYGQKHVKG SEYPRSYYKC THPNCPVKKK VERSLDGQIA EIVYQGEHHH  240
SKPKLHKRNT LEGEGQGFVS GATGQESNYS LSNSNLNEKN EGSECRSDDQ NGAEVPSSSS  300
NISKGLSCCD PMKALAIGGR SISTNDLHAL TRDCEEYTEG AEVEGDEPTS KRRKNKNKLY  360
EAGIQEEGLQ ISNGVVQSSN DSELIGDGFR WRKYGQKIVK GNPNPRSYYR CTGLRCNVRK  420
HVERASDDPT AFITTYEGKH NHHKPPVNNK NLVASGPDSK DNLKPSIKMK EASKEGGSDH  480
MAARTFPFRD LAAATKNFRA DYLLGEGGFG RVYKGRLENS NQVVAIKQLD RNGLQGNREF  540
LVEVLMLGLL HHDHLVNLIG YCADGDQRLL VYEYMPLGSL DDHLHDPSPD KRRLDWNTRM  600
KIAAGAAKGL EYLHDKASPP VIYRDLKCSN ILLGRKAVES TKTAGDHTLV AWARPLFKDR  660
RKFSQIADPM LQGEYPTRGL YQALAVAAMC VQEQPNMRPA IADVVTALSY LSSQKFDPRT  720
HPQQSSQWSP ATPPRTKRDG DRRRYDDGGC ERRY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4oa2_A1e-404846338156Protein BRASSINOSTEROID INSENSITIVE 1
4oa6_A1e-404846338156Protein BRASSINOSTEROID INSENSITIVE 1
4oa9_A1e-404846338156Protein BRASSINOSTEROID INSENSITIVE 1
4oab_A1e-404846338156Protein BRASSINOSTEROID INSENSITIVE 1
4oac_A1e-404846338156Protein BRASSINOSTEROID INSENSITIVE 1
4oh4_A1e-4048063322178Protein BRASSINOSTEROID INSENSITIVE 1
4oh4_B1e-4048063322178Protein BRASSINOSTEROID INSENSITIVE 1
4q5j_A1e-4048063322178Protein BRASSINOSTEROID INSENSITIVE 1
4q5j_B1e-4048063322178Protein BRASSINOSTEROID INSENSITIVE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007027196.11e-144WRKY family transcription factor family protein
TrEMBLA0A061ESU71e-144A0A061ESU7_THECC; WRKY family transcription factor family protein
STRINGVIT_08s0040g03070.t011e-143(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA99512227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.13e-68WRKY family protein